SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uf8c_ (5uf8 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111131Protein automated matches [190047] (28 species)
    not a true protein
  7. 2285746Species Candida albicans [TaxId:237561] [329047] (1 PDB entry)
  8. 2285846Domain d5uf8c_: 5uf8 C: [329147]
    automated match to d2k5ua_
    complexed with gdp

Details for d5uf8c_

PDB Entry: 5uf8 (more details), 1.87 Å

PDB Description: crystal structure of the arf family small gtpase arf2 from candida albicans in complex with gdp
PDB Compounds: (C:) Potential ADP-ribosylation factor

SCOPe Domain Sequences for d5uf8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uf8c_ c.37.1.8 (C:) automated matches {Candida albicans [TaxId: 237561]}
emrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirp
lwryyfqntqgiifvvdsndrdriaeareelqqmlnedelrdalllvfankqdlpnamna
aeiteklglhsirqrpwyiqatcattgdglyeglewlstnl

SCOPe Domain Coordinates for d5uf8c_:

Click to download the PDB-style file with coordinates for d5uf8c_.
(The format of our PDB-style files is described here.)

Timeline for d5uf8c_:

  • d5uf8c_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26