SCOPe 2.06: Domain d5lmkb2: 5lmk B:310-432

Lineage for d5lmkb2 (5lmk B:310-432)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
   Uniprot P20248 175-432

8. Domain d5lmkb2: 5lmk B:310-432 [329146]
   Other proteins in same PDB: d5lmka1, d5lmka2, d5lmkc1, d5lmkc2
   automated match to d1h1pb2
   complexed with 6zk, mg, sgm

Details for d5lmkb2

PDB Entry: 5lmk, 2.4 Å

PDB Description: structure of phopsho-cdk2-cyclin a in complex with an atp-competitive inhibitor

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d5lmkb2:

Sequence; same for both SEQRES and ATOM records:

>d5lmkb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d5lmkb2:

• d5lmkb2 is new in SCOPe 2.06-stable
  
• d5lmkb2 appears in SCOPe 2.07
  
• d5lmkb2 appears in the current release, SCOPe 2.08