Lineage for d5j5aa1 (5j5a A:238-606)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (47 species)
    not a true protein
  7. 2106228Species Trypanosoma brucei [TaxId:999953] [226467] (26 PDB entries)
  8. 2285842Domain d5j5aa1: 5j5a A:238-606 [329143]
    Other proteins in same PDB: d5j5aa2, d5j5ab2, d5j5ab3
    automated match to d4eg8b1
    protein/RNA complex; complexed with 756, met

Details for d5j5aa1

PDB Entry: 5j5a (more details), 2.7 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor (chem 70786556)
PDB Compounds: (A:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d5j5aa1:

Sequence, based on SEQRES records: (download)

>d5j5aa1 c.26.1.0 (A:238-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa
kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg
ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll
ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda
ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp
lpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdkn
miarlngel

Sequence, based on observed residues (ATOM records): (download)

>d5j5aa1 c.26.1.0 (A:238-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa
kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg
ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll
ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda
ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp
lpkkivahgwwtknvfdpvekaeefgydalkyfllresgfsddgdysdknmiarlngel

SCOPe Domain Coordinates for d5j5aa1:

Click to download the PDB-style file with coordinates for d5j5aa1.
(The format of our PDB-style files is described here.)

Timeline for d5j5aa1:

  • d5j5aa1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26