SCOP 1.61: Domain d1hnbb2: 1hnb B:1-84

Lineage for d1hnbb2 (1hnb B:1-84)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (27 species)

7. Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries)

8. Domain d1hnbb2: 1hnb B:1-84 [32914]
   Other proteins in same PDB: d1hnba1, d1hnbb1

Details for d1hnbb2

PDB Entry: 1hnb, 3.5 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hnbb2:

Sequence; same for both SEQRES and ATOM records:

>d1hnbb2 c.47.1.5 (B:1-84) Glutathione S-transferase {Human (Homo sapiens), class mu}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

Timeline for d1hnbb2:

• d1hnbb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hnbb2 appears in SCOP 1.59
  
• d1hnbb2 appears in SCOP 1.63
  
• d1hnbb2 appears in the current release, SCOPe 2.08