SCOPe 2.06: Domain d5ufpb_: 5ufp B:

Lineage for d5ufpb_ (5ufp B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187434] (22 PDB entries)

8. Domain d5ufpb_: 5ufp B: [329124]
   Other proteins in same PDB: d5ufpa_
   automated match to d3f1nb_
   complexed with 86d

Details for d5ufpb_

PDB Entry: 5ufp, 1.9 Å

PDB Description: crystal structure of pt2399 bound to hif2a-b*:arnt-b* complex

PDB Compounds: (B:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d5ufpb_:

Sequence; same for both SEQRES and ATOM records:

>d5ufpb_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvvk
lkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkns

Timeline for d5ufpb_:

• d5ufpb_ is new in SCOPe 2.06-stable
  
• d5ufpb_ appears in SCOPe 2.07
  
• d5ufpb_ appears in the current release, SCOPe 2.08