SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ufpb_ (5ufp B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188697Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2188938Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2189175Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2189176Protein automated matches [190492] (19 species)
    not a true protein
  7. 2189207Species Human (Homo sapiens) [TaxId:9606] [187434] (22 PDB entries)
  8. 2285823Domain d5ufpb_: 5ufp B: [329124]
    Other proteins in same PDB: d5ufpa_
    automated match to d3f1nb_
    complexed with 86d

Details for d5ufpb_

PDB Entry: 5ufp (more details), 1.9 Å

PDB Description: crystal structure of pt2399 bound to hif2a-b*:arnt-b* complex
PDB Compounds: (B:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d5ufpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ufpb_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvvk
lkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkns

SCOPe Domain Coordinates for d5ufpb_:

Click to download the PDB-style file with coordinates for d5ufpb_.
(The format of our PDB-style files is described here.)

Timeline for d5ufpb_:

  • d5ufpb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26