Lineage for d5ufpb_ (5ufp B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188697Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2188938Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2189175Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2189176Protein automated matches [190492] (20 species)
    not a true protein
  7. 2189207Species Human (Homo sapiens) [TaxId:9606] [187434] (22 PDB entries)
  8. 2285823Domain d5ufpb_: 5ufp B: [329124]
    Other proteins in same PDB: d5ufpa_
    automated match to d3f1nb_
    complexed with 86d

Details for d5ufpb_

PDB Entry: 5ufp (more details), 1.9 Å

PDB Description: crystal structure of pt2399 bound to hif2a-b*:arnt-b* complex
PDB Compounds: (B:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d5ufpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ufpb_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvvk
lkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkns

SCOPe Domain Coordinates for d5ufpb_:

Click to download the PDB-style file with coordinates for d5ufpb_.
(The format of our PDB-style files is described here.)

Timeline for d5ufpb_:

  • d5ufpb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26