Lineage for d1hncd2 (1hnc D:1-84)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244778Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 244779Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 244918Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 245016Protein Class mu GST [81359] (3 species)
  7. 245024Species Human (Homo sapiens) [TaxId:9606] [52867] (7 PDB entries)
  8. 245039Domain d1hncd2: 1hnc D:1-84 [32912]
    Other proteins in same PDB: d1hnca1, d1hncb1, d1hncc1, d1hncd1
    complexed with gdn; mutant

Details for d1hncd2

PDB Entry: 1hnc (more details), 3 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hncd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hncd2 c.47.1.5 (D:1-84) Class mu GST {Human (Homo sapiens)}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOP Domain Coordinates for d1hncd2:

Click to download the PDB-style file with coordinates for d1hncd2.
(The format of our PDB-style files is described here.)

Timeline for d1hncd2: