Lineage for d5ufpa_ (5ufp A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188697Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2188938Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2189115Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 protein domains)
    contains PAC motif
  6. 2189119Protein automated matches [191006] (1 species)
    not a true protein
  7. 2189120Species Human (Homo sapiens) [TaxId:9606] [188753] (14 PDB entries)
  8. 2285818Domain d5ufpa_: 5ufp A: [329119]
    Other proteins in same PDB: d5ufpb_
    automated match to d2a24a_
    complexed with 86d

Details for d5ufpa_

PDB Entry: 5ufp (more details), 1.9 Å

PDB Description: crystal structure of pt2399 bound to hif2a-b*:arnt-b* complex
PDB Compounds: (A:) Endothelial PAS domain-containing protein 1

SCOPe Domain Sequences for d5ufpa_:

Sequence, based on SEQRES records: (download)

>d5ufpa_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlse

Sequence, based on observed residues (ATOM records): (download)

>d5ufpa_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynppqcimcvnyvlse

SCOPe Domain Coordinates for d5ufpa_:

Click to download the PDB-style file with coordinates for d5ufpa_.
(The format of our PDB-style files is described here.)

Timeline for d5ufpa_:

  • d5ufpa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26