SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ufpa_ (5ufp A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188697Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2188938Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2189115Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 protein domains)
    contains PAC motif
  6. 2189119Protein automated matches [191006] (1 species)
    not a true protein
  7. 2189120Species Human (Homo sapiens) [TaxId:9606] [188753] (14 PDB entries)
  8. 2285818Domain d5ufpa_: 5ufp A: [329119]
    Other proteins in same PDB: d5ufpb_
    automated match to d2a24a_
    complexed with 86d

Details for d5ufpa_

PDB Entry: 5ufp (more details), 1.9 Å

PDB Description: crystal structure of pt2399 bound to hif2a-b*:arnt-b* complex
PDB Compounds: (A:) Endothelial PAS domain-containing protein 1

SCOPe Domain Sequences for d5ufpa_:

Sequence, based on SEQRES records: (download)

>d5ufpa_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlse

Sequence, based on observed residues (ATOM records): (download)

>d5ufpa_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynppqcimcvnyvlse

SCOPe Domain Coordinates for d5ufpa_:

Click to download the PDB-style file with coordinates for d5ufpa_.
(The format of our PDB-style files is described here.)

Timeline for d5ufpa_:

  • d5ufpa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26