SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ugya1 (5ugy A:5-326)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (115 PDB entries)
  8. 2285811Domain d5ugya1: 5ugy A:5-326 [329112]
    Other proteins in same PDB: d5ugya2, d5ugyb_, d5ugyc2, d5ugyd_, d5ugye2, d5ugyf_, d5ugyl1, d5ugyl2, d5ugym1, d5ugym2, d5ugyn1, d5ugyn2
    automated match to d4edba_
    complexed with bma, nag

Details for d5ugya1

PDB Entry: 5ugy (more details), 2.8 Å

PDB Description: influenza hemagglutinin in complex with a neutralizing antibody
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d5ugya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ugya1 b.19.1.2 (A:5-326) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvagw
ilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpke
sswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvhh
ppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdtii
feangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvtig
ecpkyvrsaklrmvtglrnips

SCOPe Domain Coordinates for d5ugya1:

Click to download the PDB-style file with coordinates for d5ugya1.
(The format of our PDB-style files is described here.)

Timeline for d5ugya1:

  • d5ugya1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26