SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tqhb_ (5tqh B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138634Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 protein domains)
    the active site is between the two identical subunits
  6. 2138728Protein NADP-dependent isocitrate dehydrogenase [82524] (2 species)
  7. 2138729Species Human (Homo sapiens) [TaxId:9606] [110715] (15 PDB entries)
    Uniprot O75874
  8. 2285807Domain d5tqhb_: 5tqh B: [329108]
    automated match to d1t0la_
    complexed with 7j2, flc, ndp; mutant

Details for d5tqhb_

PDB Entry: 5tqh (more details), 2.2 Å

PDB Description: idh1 r132h mutant in complex with idh889
PDB Compounds: (B:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d5tqhb_:

Sequence, based on SEQRES records: (download)

>d5tqhb_ c.77.1.1 (B:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
gwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt
veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev
sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqa

Sequence, based on observed residues (ATOM records): (download)

>d5tqhb_ c.77.1.1 (B:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
gwvkpiiighhdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgmynq
dksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaqkiw
yehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgktvea
eaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleevsie
tieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqa

SCOPe Domain Coordinates for d5tqhb_:

Click to download the PDB-style file with coordinates for d5tqhb_.
(The format of our PDB-style files is described here.)

Timeline for d5tqhb_:

  • d5tqhb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26