SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wv1a_ (5wv1 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207715Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2207716Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2207717Family d.165.1.1: Plant cytotoxins [56372] (18 protein domains)
  6. 2207869Protein automated matches [190420] (8 species)
    not a true protein
  7. 2207893Species Momordica balsamina [TaxId:3672] [189375] (73 PDB entries)
  8. 2285806Domain d5wv1a_: 5wv1 A: [329107]
    automated match to d3my6a_
    complexed with gol, nag, rib

Details for d5wv1a_

PDB Entry: 5wv1 (more details), 1.9 Å

PDB Description: crystal structure of the complex of ribosome inactivating protein from momordica balsamina with ribose sugar at 1.90 a resolution.
PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d5wv1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wv1a_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d5wv1a_:

Click to download the PDB-style file with coordinates for d5wv1a_.
(The format of our PDB-style files is described here.)

Timeline for d5wv1a_:

  • d5wv1a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26