Lineage for d5wv1a_ (5wv1 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207715Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2207716Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2207717Family d.165.1.1: Plant cytotoxins [56372] (18 protein domains)
  6. 2207869Protein automated matches [190420] (8 species)
    not a true protein
  7. 2207893Species Momordica balsamina [TaxId:3672] [189375] (74 PDB entries)
  8. 2285806Domain d5wv1a_: 5wv1 A: [329107]
    automated match to d3my6a_
    complexed with gol, nag, rib

Details for d5wv1a_

PDB Entry: 5wv1 (more details), 1.9 Å

PDB Description: crystal structure of the complex of ribosome inactivating protein from momordica balsamina with ribose sugar at 1.90 a resolution.
PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d5wv1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wv1a_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d5wv1a_:

Click to download the PDB-style file with coordinates for d5wv1a_.
(The format of our PDB-style files is described here.)

Timeline for d5wv1a_:

  • d5wv1a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26