Lineage for d5tpga_ (5tpg A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2561676Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 2561677Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 2561678Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 protein domains)
  6. 2561724Protein automated matches [191203] (3 species)
    not a true protein
  7. 2561729Species Human (Homo sapiens) [TaxId:9606] [189544] (5 PDB entries)
  8. 2561730Domain d5tpga_: 5tpg A: [329101]
    automated match to d3e2ta_
    complexed with 7h5, ccn, fe, trs

Details for d5tpga_

PDB Entry: 5tpg (more details), 1.5 Å

PDB Description: optimization of spirocyclic proline tryptophanhydroxylase-1 inhibitors
PDB Compounds: (A:) Tryptophan 5-hydroxylase 1

SCOPe Domain Sequences for d5tpga_:

Sequence, based on SEQRES records: (download)

>d5tpga_ d.178.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvpwfpkkisdldhcanrvlmygseldadhpgfkdnvyrkrrkyfadlamnykhgdpipk
vefteeeiktwgtvfqelnklypthacreylknlpllskycgyrednipqledvsnflke
rtgfsirpvagylsprdflsglafrvfhctqyvrhssdpfytpepdtchellghvpllae
psfaqfsqeiglaslgaseeavqklatcyfftvefglckqdgqlrvfgagllssiselkh
alsghakvkpfdpkitckqeclittfqdvyfvsesfedakekmreftktik

Sequence, based on observed residues (ATOM records): (download)

>d5tpga_ d.178.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvpwfpkkisdldhcnvyrkrrkyfadlamnykhgdpipkvefteeeiktwgtvfqelnk
lypthacreylknlpllskycgyrednipqledvsnflkertgfsirpvagylsprdfls
glafrvfhctqyvrhssdpfytpepdtchellghvpllaepsfaqfsqeiglaslgasee
avqklatcyfftvefglckqdgqlrvfgagllssiselkhalsghakvkpfdpkitckqe
clittfqdvyfvsesfedakekmreftktik

SCOPe Domain Coordinates for d5tpga_:

Click to download the PDB-style file with coordinates for d5tpga_.
(The format of our PDB-style files is described here.)

Timeline for d5tpga_: