SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tpga_ (5tpg A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211236Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 2211237Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 2211238Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 protein domains)
  6. 2211284Protein automated matches [191203] (3 species)
    not a true protein
  7. 2211289Species Human (Homo sapiens) [TaxId:9606] [189544] (5 PDB entries)
  8. 2285800Domain d5tpga_: 5tpg A: [329101]
    automated match to d3e2ta_
    complexed with 7h5, ccn, fe, trs

Details for d5tpga_

PDB Entry: 5tpg (more details), 1.5 Å

PDB Description: optimization of spirocyclic proline tryptophanhydroxylase-1 inhibitors
PDB Compounds: (A:) Tryptophan 5-hydroxylase 1

SCOPe Domain Sequences for d5tpga_:

Sequence, based on SEQRES records: (download)

>d5tpga_ d.178.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvpwfpkkisdldhcanrvlmygseldadhpgfkdnvyrkrrkyfadlamnykhgdpipk
vefteeeiktwgtvfqelnklypthacreylknlpllskycgyrednipqledvsnflke
rtgfsirpvagylsprdflsglafrvfhctqyvrhssdpfytpepdtchellghvpllae
psfaqfsqeiglaslgaseeavqklatcyfftvefglckqdgqlrvfgagllssiselkh
alsghakvkpfdpkitckqeclittfqdvyfvsesfedakekmreftktik

Sequence, based on observed residues (ATOM records): (download)

>d5tpga_ d.178.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvpwfpkkisdldhcnvyrkrrkyfadlamnykhgdpipkvefteeeiktwgtvfqelnk
lypthacreylknlpllskycgyrednipqledvsnflkertgfsirpvagylsprdfls
glafrvfhctqyvrhssdpfytpepdtchellghvpllaepsfaqfsqeiglaslgasee
avqklatcyfftvefglckqdgqlrvfgagllssiselkhalsghakvkpfdpkitckqe
clittfqdvyfvsesfedakekmreftktik

SCOPe Domain Coordinates for d5tpga_:

Click to download the PDB-style file with coordinates for d5tpga_.
(The format of our PDB-style files is described here.)

Timeline for d5tpga_:

  • d5tpga_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26