Lineage for d5tpga_ (5tpg A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211236Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 2211237Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 2211238Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 protein domains)
  6. 2211284Protein automated matches [191203] (3 species)
    not a true protein
  7. 2211289Species Human (Homo sapiens) [TaxId:9606] [189544] (5 PDB entries)
  8. 2285800Domain d5tpga_: 5tpg A: [329101]
    automated match to d3e2ta_
    complexed with 7h5, ccn, fe, trs

Details for d5tpga_

PDB Entry: 5tpg (more details), 1.5 Å

PDB Description: optimization of spirocyclic proline tryptophanhydroxylase-1 inhibitors
PDB Compounds: (A:) Tryptophan 5-hydroxylase 1

SCOPe Domain Sequences for d5tpga_:

Sequence, based on SEQRES records: (download)

>d5tpga_ d.178.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvpwfpkkisdldhcanrvlmygseldadhpgfkdnvyrkrrkyfadlamnykhgdpipk
vefteeeiktwgtvfqelnklypthacreylknlpllskycgyrednipqledvsnflke
rtgfsirpvagylsprdflsglafrvfhctqyvrhssdpfytpepdtchellghvpllae
psfaqfsqeiglaslgaseeavqklatcyfftvefglckqdgqlrvfgagllssiselkh
alsghakvkpfdpkitckqeclittfqdvyfvsesfedakekmreftktik

Sequence, based on observed residues (ATOM records): (download)

>d5tpga_ d.178.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvpwfpkkisdldhcnvyrkrrkyfadlamnykhgdpipkvefteeeiktwgtvfqelnk
lypthacreylknlpllskycgyrednipqledvsnflkertgfsirpvagylsprdfls
glafrvfhctqyvrhssdpfytpepdtchellghvpllaepsfaqfsqeiglaslgasee
avqklatcyfftvefglckqdgqlrvfgagllssiselkhalsghakvkpfdpkitckqe
clittfqdvyfvsesfedakekmreftktik

SCOPe Domain Coordinates for d5tpga_:

Click to download the PDB-style file with coordinates for d5tpga_.
(The format of our PDB-style files is described here.)

Timeline for d5tpga_:

  • d5tpga_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26