Lineage for d5wy9a_ (5wy9 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063481Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2063482Protein automated matches [190698] (20 species)
    not a true protein
  7. 2063506Species Human (Homo sapiens) [TaxId:9606] [187833] (30 PDB entries)
  8. 2285799Domain d5wy9a_: 5wy9 A: [329100]
    automated match to d4oryf_
    complexed with 1pg, pg0

Details for d5wy9a_

PDB Entry: 5wy9 (more details), 1.45 Å

PDB Description: apo form crystal structure of human lipocalin pgds .
PDB Compounds: (A:) Prostaglandin-H2 D-isomerase

SCOPe Domain Sequences for d5wy9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wy9a_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvsvqpnfqqdkflgrwfsaglasnsswlrekkaalsmcksvvapatdgglnltstflrk
nqcetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrma
tlysrtqtpraelkekftafckaqgftedtivflpqtd

SCOPe Domain Coordinates for d5wy9a_:

Click to download the PDB-style file with coordinates for d5wy9a_.
(The format of our PDB-style files is described here.)

Timeline for d5wy9a_:

  • d5wy9a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26