SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wy9a_ (5wy9 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063481Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2063482Protein automated matches [190698] (18 species)
    not a true protein
  7. 2063506Species Human (Homo sapiens) [TaxId:9606] [187833] (26 PDB entries)
  8. 2285799Domain d5wy9a_: 5wy9 A: [329100]
    automated match to d4oryf_
    complexed with 1pg, pg0

Details for d5wy9a_

PDB Entry: 5wy9 (more details), 1.45 Å

PDB Description: apo form crystal structure of human lipocalin pgds .
PDB Compounds: (A:) Prostaglandin-H2 D-isomerase

SCOPe Domain Sequences for d5wy9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wy9a_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvsvqpnfqqdkflgrwfsaglasnsswlrekkaalsmcksvvapatdgglnltstflrk
nqcetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrma
tlysrtqtpraelkekftafckaqgftedtivflpqtd

SCOPe Domain Coordinates for d5wy9a_:

Click to download the PDB-style file with coordinates for d5wy9a_.
(The format of our PDB-style files is described here.)

Timeline for d5wy9a_:

  • d5wy9a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26