Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins) |
Protein Class mu GST [81359] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [52867] (7 PDB entries) |
Domain d1hncb2: 1hnc B:1-84 [32910] Other proteins in same PDB: d1hnca1, d1hncb1, d1hncc1, d1hncd1 |
PDB Entry: 1hnc (more details), 3 Å
SCOP Domain Sequences for d1hncb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hncb2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens)} pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgthkitqsnailryiarkhn
Timeline for d1hncb2: