SCOPe 2.06: Domain d5uf8d_: 5uf8 D:

Lineage for d5uf8d_ (5uf8 D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Candida albicans [TaxId:237561] [329047] (1 PDB entry)

8. Domain d5uf8d_: 5uf8 D: [329096]
   automated match to d2k5ua_
   complexed with gdp

Details for d5uf8d_

PDB Entry: 5uf8, 1.87 Å

PDB Description: crystal structure of the arf family small gtpase arf2 from candida albicans in complex with gdp

PDB Compounds: (D:) Potential ADP-ribosylation factor

SCOPe Domain Sequences for d5uf8d_:

Sequence, based on SEQRES records:

>d5uf8d_ c.37.1.8 (D:) automated matches {Candida albicans [TaxId: 237561]}
gnkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdk
irplwryyfqntqgiifvvdsndrdriaeareelqqmlnedelrdalllvfankqdlpna
mnaaeiteklglhsirqrpwyiqatcattgdglyeglewlstnl

Sequence, based on observed residues (ATOM records):

>d5uf8d_ c.37.1.8 (D:) automated matches {Candida albicans [TaxId: 237561]}
gnkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvgirpl
wryyfqntqgiifvvdsndrdriaeareelqqmlnedelrdalllvfankqdlpnamnaa
eiteklglhsirqrpwyiqatcattgdglyeglewlstnl

Timeline for d5uf8d_:

• d5uf8d_ is new in SCOPe 2.06-stable
  
• d5uf8d_ appears in SCOPe 2.07
  
• d5uf8d_ appears in the current release, SCOPe 2.08