![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (80 protein domains) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein automated matches [190047] (29 species) not a true protein |
![]() | Species Candida albicans [TaxId:237561] [329047] (1 PDB entry) |
![]() | Domain d5uf8d_: 5uf8 D: [329096] automated match to d2k5ua_ complexed with gdp |
PDB Entry: 5uf8 (more details), 1.87 Å
SCOPe Domain Sequences for d5uf8d_:
Sequence, based on SEQRES records: (download)
>d5uf8d_ c.37.1.8 (D:) automated matches {Candida albicans [TaxId: 237561]} gnkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdk irplwryyfqntqgiifvvdsndrdriaeareelqqmlnedelrdalllvfankqdlpna mnaaeiteklglhsirqrpwyiqatcattgdglyeglewlstnl
>d5uf8d_ c.37.1.8 (D:) automated matches {Candida albicans [TaxId: 237561]} gnkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvgirpl wryyfqntqgiifvvdsndrdriaeareelqqmlnedelrdalllvfankqdlpnamnaa eiteklglhsirqrpwyiqatcattgdglyeglewlstnl
Timeline for d5uf8d_: