Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
Protein automated matches [191087] (19 species) not a true protein |
Species Naegleria fowleri [TaxId:5763] [329036] (1 PDB entry) |
Domain d5u2ic1: 5u2i C:2-151 [329094] Other proteins in same PDB: d5u2ia2, d5u2ib2, d5u2ic2, d5u2id2, d5u2ie2, d5u2if2 automated match to d4uoha_ complexed with edo, fmt, mg |
PDB Entry: 5u2i (more details), 1.4 Å
SCOPe Domain Sequences for d5u2ic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u2ic1 d.58.6.0 (C:2-151) automated matches {Naegleria fowleri [TaxId: 5763]} snertfialkpdavqrglvgtiiarfeqkgfklvalklitpsadlakkhyaehdgkpffn glvefltsgpvaamvwegkgvvaaarkmigatkplesapgtirgdfaidvgrniihgsda vetaqreialwfqdselnewtptqnkwiye
Timeline for d5u2ic1: