SCOPe 2.08: Domain d5u2ic1: 5u2i C:2-151

Lineage for d5u2ic1 (5u2i C:2-151)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.0: automated matches [191597] (1 protein)
   not a true family

6. Protein automated matches [191087] (19 species)
   not a true protein

7. Species Naegleria fowleri [TaxId:5763] [329036] (1 PDB entry)

8. Domain d5u2ic1: 5u2i C:2-151 [329094]
   Other proteins in same PDB: d5u2ia2, d5u2ib2, d5u2ic2, d5u2id2, d5u2ie2, d5u2if2
   automated match to d4uoha_
   complexed with edo, fmt, mg

Details for d5u2ic1

PDB Entry: 5u2i, 1.4 Å

PDB Description: crystal structure of a nucleoside diphosphate kinase from naegleria fowleri

PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5u2ic1:

Sequence; same for both SEQRES and ATOM records:

>d5u2ic1 d.58.6.0 (C:2-151) automated matches {Naegleria fowleri [TaxId: 5763]}
snertfialkpdavqrglvgtiiarfeqkgfklvalklitpsadlakkhyaehdgkpffn
glvefltsgpvaamvwegkgvvaaarkmigatkplesapgtirgdfaidvgrniihgsda
vetaqreialwfqdselnewtptqnkwiye

Timeline for d5u2ic1:

• d5u2ic1 first appeared in SCOPe 2.06
  
• d5u2ic1 appears in SCOPe 2.07