Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins) |
Protein Glutathione S-transferase [52863] (24 species) |
Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries) |
Domain d1hnca2: 1hnc A:1-84 [32909] Other proteins in same PDB: d1hnca1, d1hncb1, d1hncc1, d1hncd1 |
PDB Entry: 1hnc (more details), 3 Å
SCOP Domain Sequences for d1hnca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnca2 c.47.1.5 (A:1-84) Glutathione S-transferase {Human (Homo sapiens), class mu} pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgthkitqsnailryiarkhn
Timeline for d1hnca2: