Lineage for d1hnca2 (1hnc A:1-84)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123318Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 123330Protein Glutathione S-transferase [52863] (24 species)
  7. 123373Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries)
  8. 123385Domain d1hnca2: 1hnc A:1-84 [32909]
    Other proteins in same PDB: d1hnca1, d1hncb1, d1hncc1, d1hncd1

Details for d1hnca2

PDB Entry: 1hnc (more details), 3 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hnca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnca2 c.47.1.5 (A:1-84) Glutathione S-transferase {Human (Homo sapiens), class mu}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOP Domain Coordinates for d1hnca2:

Click to download the PDB-style file with coordinates for d1hnca2.
(The format of our PDB-style files is described here.)

Timeline for d1hnca2: