SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ug4b_ (5ug4 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2188102Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2188103Protein automated matches [190038] (37 species)
    not a true protein
  7. 2188331Species Vibrio cholerae [TaxId:666] [188612] (13 PDB entries)
  8. 2285782Domain d5ug4b_: 5ug4 B: [329083]
    automated match to d4jlya_
    complexed with act, ca, eoh, moh, mrd

Details for d5ug4b_

PDB Entry: 5ug4 (more details), 2.15 Å

PDB Description: structure of spermidine n-acetyltransferase speg from vibrio cholerae
PDB Compounds: (B:) Spermidine N(1)-acetyltransferase

SCOPe Domain Sequences for d5ug4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ug4b_ d.108.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln

SCOPe Domain Coordinates for d5ug4b_:

Click to download the PDB-style file with coordinates for d5ug4b_.
(The format of our PDB-style files is described here.)

Timeline for d5ug4b_:

  • d5ug4b_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26