Lineage for d3gtud2 (3gtu D:1-84)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315307Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 315308Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 315468Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 315577Protein Class mu GST [81359] (3 species)
  7. 315585Species Human (Homo sapiens) [TaxId:9606] [52867] (7 PDB entries)
  8. 315596Domain d3gtud2: 3gtu D:1-84 [32908]
    Other proteins in same PDB: d3gtua1, d3gtub1, d3gtuc1, d3gtud1

Details for d3gtud2

PDB Entry: 3gtu (more details), 2.8 Å

PDB Description: ligand-free heterodimeric human glutathione s-transferase m2-3 (ec 2.5.1.18), monoclinic crystal form

SCOP Domain Sequences for d3gtud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gtud2 c.47.1.5 (D:1-84) Class mu GST {Human (Homo sapiens)}
scessmvlgywdirglahairllleftdtsyeekrytcgeapdydrsqwldvkfkldldf
pnlpylldgknkitqsnailryia

SCOP Domain Coordinates for d3gtud2:

Click to download the PDB-style file with coordinates for d3gtud2.
(The format of our PDB-style files is described here.)

Timeline for d3gtud2:

315596
d3gtud2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3gtud1