SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ui2b1 (5ui2 B:2-175)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014191Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 2014192Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
    automatically mapped to Pfam PF09150
  5. 2014193Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 protein domains)
  6. 2014194Protein Orange carotenoid protein, N-terminal domain [81932] (1 species)
  7. 2014195Species Arthrospira maxima [TaxId:129910] [81933] (2 PDB entries)
  8. 2285777Domain d5ui2b1: 5ui2 B:2-175 [329078]
    Other proteins in same PDB: d5ui2a2, d5ui2b2
    automated match to d1m98a1
    complexed with cl, eq3, suc

Details for d5ui2b1

PDB Entry: 5ui2 (more details), 2.1 Å

PDB Description: crystal structure of orange carotenoid protein
PDB Compounds: (B:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d5ui2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ui2b1 a.175.1.1 (B:2-175) Orange carotenoid protein, N-terminal domain {Arthrospira maxima [TaxId: 129910]}
pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm
qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl
vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrva

SCOPe Domain Coordinates for d5ui2b1:

Click to download the PDB-style file with coordinates for d5ui2b1.
(The format of our PDB-style files is described here.)

Timeline for d5ui2b1:

  • d5ui2b1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26

View in 3D
Domains from same chain:
(mouse over for more information)
d5ui2b2