Lineage for d5ui2b1 (5ui2 B:2-175)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014191Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 2014192Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
    automatically mapped to Pfam PF09150
  5. 2014193Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 protein domains)
  6. 2014194Protein Orange carotenoid protein, N-terminal domain [81932] (1 species)
  7. 2014195Species Arthrospira maxima [TaxId:129910] [81933] (2 PDB entries)
  8. 2285777Domain d5ui2b1: 5ui2 B:2-175 [329078]
    Other proteins in same PDB: d5ui2a2, d5ui2b2
    automated match to d1m98a1
    complexed with cl, eq3, suc

Details for d5ui2b1

PDB Entry: 5ui2 (more details), 2.1 Å

PDB Description: crystal structure of orange carotenoid protein
PDB Compounds: (B:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d5ui2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ui2b1 a.175.1.1 (B:2-175) Orange carotenoid protein, N-terminal domain {Arthrospira maxima [TaxId: 129910]}
pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm
qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl
vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrva

SCOPe Domain Coordinates for d5ui2b1:

Click to download the PDB-style file with coordinates for d5ui2b1.
(The format of our PDB-style files is described here.)

Timeline for d5ui2b1:

  • d5ui2b1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26

View in 3D
Domains from same chain:
(mouse over for more information)
d5ui2b2