SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m2bv_ (5m2b V:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2204191Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2285776Domain d5m2bv_: 5m2b V: [329077]
    Other proteins in same PDB: d5m2ba_, d5m2bc_, d5m2bd_, d5m2be_, d5m2bg_, d5m2bi_, d5m2bj_, d5m2bn_, d5m2bo_, d5m2bq_, d5m2br_, d5m2bs_, d5m2bu_, d5m2bw_, d5m2bx_
    automated match to d4r17h_
    complexed with 7dx, cl, mg

Details for d5m2bv_

PDB Entry: 5m2b (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with thiazole based inhibitor ro19
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5m2bv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m2bv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d5m2bv_:

Click to download the PDB-style file with coordinates for d5m2bv_.
(The format of our PDB-style files is described here.)

Timeline for d5m2bv_:

  • d5m2bv_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26