Lineage for d5u2ia1 (5u2i A:2-151)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518280Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2518815Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2518816Protein automated matches [191087] (15 species)
    not a true protein
  7. 2518928Species Naegleria fowleri [TaxId:5763] [329036] (1 PDB entry)
  8. 2518929Domain d5u2ia1: 5u2i A:2-151 [329073]
    Other proteins in same PDB: d5u2ia2, d5u2ib2, d5u2ic2, d5u2id2, d5u2ie2, d5u2if2
    automated match to d4uoha_
    complexed with edo, fmt, mg

Details for d5u2ia1

PDB Entry: 5u2i (more details), 1.4 Å

PDB Description: crystal structure of a nucleoside diphosphate kinase from naegleria fowleri
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5u2ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u2ia1 d.58.6.0 (A:2-151) automated matches {Naegleria fowleri [TaxId: 5763]}
snertfialkpdavqrglvgtiiarfeqkgfklvalklitpsadlakkhyaehdgkpffn
glvefltsgpvaamvwegkgvvaaarkmigatkplesapgtirgdfaidvgrniihgsda
vetaqreialwfqdselnewtptqnkwiye

SCOPe Domain Coordinates for d5u2ia1:

Click to download the PDB-style file with coordinates for d5u2ia1.
(The format of our PDB-style files is described here.)

Timeline for d5u2ia1: