Lineage for d5ug4c_ (5ug4 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533769Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2533770Protein automated matches [190038] (43 species)
    not a true protein
  7. 2534126Species Vibrio cholerae [TaxId:666] [188612] (13 PDB entries)
  8. 2534157Domain d5ug4c_: 5ug4 C: [329072]
    automated match to d4jlya_
    complexed with act, ca, eoh, moh, mrd

Details for d5ug4c_

PDB Entry: 5ug4 (more details), 2.15 Å

PDB Description: structure of spermidine n-acetyltransferase speg from vibrio cholerae
PDB Compounds: (C:) Spermidine N(1)-acetyltransferase

SCOPe Domain Sequences for d5ug4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ug4c_ d.108.1.0 (C:) automated matches {Vibrio cholerae [TaxId: 666]}
sqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvved
aqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylh
vavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse

SCOPe Domain Coordinates for d5ug4c_:

Click to download the PDB-style file with coordinates for d5ug4c_.
(The format of our PDB-style files is described here.)

Timeline for d5ug4c_: