SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wrzb1 (5wrz B:662-796)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996130Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 1996131Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 1996156Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 1996157Protein automated matches [226964] (1 species)
    not a true protein
  7. 1996158Species Human (Homo sapiens) [TaxId:9606] [225405] (44 PDB entries)
  8. 2285764Domain d5wrzb1: 5wrz B:662-796 [329065]
    Other proteins in same PDB: d5wrza2, d5wrza3, d5wrzb2, d5wrzb3
    automated match to d4hhyd1
    complexed with 7u3

Details for d5wrzb1

PDB Entry: 5wrz (more details), 2.2 Å

PDB Description: structure of human parp1 catalytic domain bound to a phthalazinone inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5wrzb1:

Sequence, based on SEQRES records: (download)

>d5wrzb1 a.41.1.0 (B:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
sddsskdpidvnyek

Sequence, based on observed residues (ATOM records): (download)

>d5wrzb1 a.41.1.0 (B:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgsdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrggs
ddsskdpidvnyek

SCOPe Domain Coordinates for d5wrzb1:

Click to download the PDB-style file with coordinates for d5wrzb1.
(The format of our PDB-style files is described here.)

Timeline for d5wrzb1:

  • d5wrzb1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26