Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225406] (56 PDB entries) |
Domain d5ws1b2: 5ws1 B:797-1011 [329063] Other proteins in same PDB: d5ws1a1, d5ws1a3, d5ws1b1, d5ws1b3 automated match to d4hhyd2 complexed with 7u9 |
PDB Entry: 5ws1 (more details), 1.9 Å
SCOPe Domain Sequences for d5ws1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ws1b2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]} lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis sgvndtsllyneyivydiaqvnlkyllklkfnfkt
Timeline for d5ws1b2: