Lineage for d5momc1 (5mom C:1-126)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2193533Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2193534Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2193902Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2193903Protein automated matches [226907] (17 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [254935] (3 PDB entries)
  8. 2285759Domain d5momc1: 5mom C:1-126 [329060]
    automated match to d1plqa1
    mutant

Details for d5momc1

PDB Entry: 5mom (more details), 2.27 Å

PDB Description: crystal structure of pcna encoding the hypomorphic mutation s228i
PDB Compounds: (C:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5momc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5momc1 d.131.1.0 (C:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOPe Domain Coordinates for d5momc1:

Click to download the PDB-style file with coordinates for d5momc1.
(The format of our PDB-style files is described here.)

Timeline for d5momc1:

  • d5momc1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26