SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5momc1 (5mom C:1-126)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2193533Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2193534Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2193902Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2193903Protein automated matches [226907] (15 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [254935] (3 PDB entries)
  8. 2285759Domain d5momc1: 5mom C:1-126 [329060]
    automated match to d1plqa1
    mutant

Details for d5momc1

PDB Entry: 5mom (more details), 2.27 Å

PDB Description: crystal structure of pcna encoding the hypomorphic mutation s228i
PDB Compounds: (C:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5momc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5momc1 d.131.1.0 (C:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOPe Domain Coordinates for d5momc1:

Click to download the PDB-style file with coordinates for d5momc1.
(The format of our PDB-style files is described here.)

Timeline for d5momc1:

  • d5momc1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26