SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hqmb1 (5hqm B:1-138)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2175267Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2175463Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2175464Protein automated matches [226983] (17 species)
    not a true protein
  7. 2285611Species Rhodospirillum rubrum [TaxId:1085] [328912] (1 PDB entry)
  8. 2285755Domain d5hqmb1: 5hqm B:1-138 [329056]
    Other proteins in same PDB: d5hqma2, d5hqmb2
    automated match to d4lf2a1
    complexed with cap, k, mg

Details for d5hqmb1

PDB Entry: 5hqm (more details), 1.95 Å

PDB Description: structure function studies of r. palustris rubisco (r. palustris/r. rubrum chimera)
PDB Compounds: (B:) Ribulose bisphosphate carboxylase (R. palustris/R. rubrum chimera),Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hqmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hqmb1 d.58.9.0 (B:1-138) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d5hqmb1:

Click to download the PDB-style file with coordinates for d5hqmb1.
(The format of our PDB-style files is described here.)

Timeline for d5hqmb1:

  • d5hqmb1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26

View in 3D
Domains from same chain:
(mouse over for more information)
d5hqmb2