Lineage for d5ws1a2 (5ws1 A:797-1011)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208074Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2208075Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2208361Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2208362Protein automated matches [191197] (9 species)
    not a true protein
  7. 2208398Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries)
  8. 2285753Domain d5ws1a2: 5ws1 A:797-1011 [329054]
    Other proteins in same PDB: d5ws1a1, d5ws1a3, d5ws1b1, d5ws1b3
    automated match to d4hhyd2
    complexed with 7u9

Details for d5ws1a2

PDB Entry: 5ws1 (more details), 1.9 Å

PDB Description: structure of human parp1 catalytic domain bound to a benzoimidazole inhibitor
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5ws1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws1a2 d.166.1.0 (A:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d5ws1a2:

Click to download the PDB-style file with coordinates for d5ws1a2.
(The format of our PDB-style files is described here.)

Timeline for d5ws1a2:

  • d5ws1a2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26