SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5twta_ (5twt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2003088Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2003089Protein automated matches [191104] (11 species)
    not a true protein
  7. 2285750Species Panicum virgatum [TaxId:38727] [329051] (1 PDB entry)
  8. 2285751Domain d5twta_: 5twt A: [329052]
    automated match to d5aoga_
    complexed with ca, hem, so4

Details for d5twta_

PDB Entry: 5twt (more details), 1.3 Å

PDB Description: characterization of class iii peroxidase from switchgrass (panicum virgatum)
PDB Compounds: (A:) Peroxidase Pvi9

SCOPe Domain Sequences for d5twta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5twta_ a.93.1.0 (A:) automated matches {Panicum virgatum [TaxId: 38727]}
qlsstfydtscpnalstirsavnaavaqenrmgasllrlhfhdcfvqgcdasvllndtng
geqnalpnagslrgfgvidnikaqvealcpqtvscadilavaardsvvalggpswtvplg
rrdstnssaalansdlpppqfnlsqlitafgnknldptdlvalsgahtigqaqclnfrah
itepninptfaaslrancpatggdtnlapldvttpntfdnayytnllnqrgllhsdqelf
nnastdstvrnfasnaaafttafttamikmgnlqpltgtqgqirrncwrvn

SCOPe Domain Coordinates for d5twta_:

Click to download the PDB-style file with coordinates for d5twta_.
(The format of our PDB-style files is described here.)

Timeline for d5twta_:

  • d5twta_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26