Lineage for d5twta_ (5twt A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328973Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2328974Protein automated matches [191104] (13 species)
    not a true protein
  7. 2329055Species Panicum virgatum [TaxId:38727] [329051] (1 PDB entry)
  8. 2329056Domain d5twta_: 5twt A: [329052]
    automated match to d5aoga_
    complexed with ca, hem, so4

Details for d5twta_

PDB Entry: 5twt (more details), 1.3 Å

PDB Description: characterization of class iii peroxidase from switchgrass (panicum virgatum)
PDB Compounds: (A:) Peroxidase Pvi9

SCOPe Domain Sequences for d5twta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5twta_ a.93.1.0 (A:) automated matches {Panicum virgatum [TaxId: 38727]}
qlsstfydtscpnalstirsavnaavaqenrmgasllrlhfhdcfvqgcdasvllndtng
geqnalpnagslrgfgvidnikaqvealcpqtvscadilavaardsvvalggpswtvplg
rrdstnssaalansdlpppqfnlsqlitafgnknldptdlvalsgahtigqaqclnfrah
itepninptfaaslrancpatggdtnlapldvttpntfdnayytnllnqrgllhsdqelf
nnastdstvrnfasnaaafttafttamikmgnlqpltgtqgqirrncwrvn

SCOPe Domain Coordinates for d5twta_:

Click to download the PDB-style file with coordinates for d5twta_.
(The format of our PDB-style files is described here.)

Timeline for d5twta_: