SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u2ib1 (5u2i B:2-151)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2173863Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2174362Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2174363Protein automated matches [191087] (11 species)
    not a true protein
  7. 2285735Species Naegleria fowleri [TaxId:5763] [329036] (1 PDB entry)
  8. 2285744Domain d5u2ib1: 5u2i B:2-151 [329045]
    Other proteins in same PDB: d5u2ia2, d5u2ib2, d5u2ic2, d5u2id2, d5u2ie2, d5u2if2
    automated match to d4uoha_
    complexed with edo, fmt, mg

Details for d5u2ib1

PDB Entry: 5u2i (more details), 1.4 Å

PDB Description: crystal structure of a nucleoside diphosphate kinase from naegleria fowleri
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5u2ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u2ib1 d.58.6.0 (B:2-151) automated matches {Naegleria fowleri [TaxId: 5763]}
snertfialkpdavqrglvgtiiarfeqkgfklvalklitpsadlakkhyaehdgkpffn
glvefltsgpvaamvwegkgvvaaarkmigatkplesapgtirgdfaidvgrniihgsda
vetaqreialwfqdselnewtptqnkwiye

SCOPe Domain Coordinates for d5u2ib1:

Click to download the PDB-style file with coordinates for d5u2ib1.
(The format of our PDB-style files is described here.)

Timeline for d5u2ib1:

  • d5u2ib1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26