SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uc7a1 (5uc7 A:1-429)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131998Protein automated matches [190152] (22 species)
    not a true protein
  7. 2285741Species Citrobacter rodentium [TaxId:97825] [329042] (1 PDB entry)
  8. 2285742Domain d5uc7a1: 5uc7 A:1-429 [329043]
    Other proteins in same PDB: d5uc7a2
    automated match to d1mlya_
    complexed with tar

Details for d5uc7a1

PDB Entry: 5uc7 (more details), 1.84 Å

PDB Description: crystal structure of bioa / 7,8-diaminopelargonic acid aminotransferase / dapa synthase from citrobacter rodentium, plp complex
PDB Compounds: (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d5uc7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uc7a1 c.67.1.4 (A:1-429) automated matches {Citrobacter rodentium [TaxId: 97825]}
mttddlafdrrhiwhpytsmtsplpvfpveraegcelilsggerlvdgmsswwaaihgyn
hpqlnaamktqidamshvmfggithapaielcrklvamtpaplecvfladsgsvavevam
kmalqywqakgesrqrfltfrngyhgdtfgamsvcdphnsmhslwkgylaenlfapapqs
rmggewderdmvafarlmaahrheiaavilepivqgaggmriyhpqwlqrirqmcdregi
lliadeiatgfgrtgrlfacehagiapdilclgkaltggtmtlsatltsrqvaetisnge
agcfmhgptfmgnplacavanasltllesgdwrrqvaaieaqlreelapaadspqvadvr
vlgaigvvettrpvniaalqqffvrqgvwvrpfgkliylmppyiiqpeqlrrltqavnea
vreetffsv

SCOPe Domain Coordinates for d5uc7a1:

Click to download the PDB-style file with coordinates for d5uc7a1.
(The format of our PDB-style files is described here.)

Timeline for d5uc7a1:

  • d5uc7a1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26

View in 3D
Domains from same chain:
(mouse over for more information)
d5uc7a2