Lineage for d5uc7a1 (5uc7 A:1-429)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131998Protein automated matches [190152] (22 species)
    not a true protein
  7. 2285741Species Citrobacter rodentium [TaxId:97825] [329042] (1 PDB entry)
  8. 2285742Domain d5uc7a1: 5uc7 A:1-429 [329043]
    Other proteins in same PDB: d5uc7a2
    automated match to d1mlya_
    complexed with tar

Details for d5uc7a1

PDB Entry: 5uc7 (more details), 1.84 Å

PDB Description: crystal structure of bioa / 7,8-diaminopelargonic acid aminotransferase / dapa synthase from citrobacter rodentium, plp complex
PDB Compounds: (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d5uc7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uc7a1 c.67.1.4 (A:1-429) automated matches {Citrobacter rodentium [TaxId: 97825]}
mttddlafdrrhiwhpytsmtsplpvfpveraegcelilsggerlvdgmsswwaaihgyn
hpqlnaamktqidamshvmfggithapaielcrklvamtpaplecvfladsgsvavevam
kmalqywqakgesrqrfltfrngyhgdtfgamsvcdphnsmhslwkgylaenlfapapqs
rmggewderdmvafarlmaahrheiaavilepivqgaggmriyhpqwlqrirqmcdregi
lliadeiatgfgrtgrlfacehagiapdilclgkaltggtmtlsatltsrqvaetisnge
agcfmhgptfmgnplacavanasltllesgdwrrqvaaieaqlreelapaadspqvadvr
vlgaigvvettrpvniaalqqffvrqgvwvrpfgkliylmppyiiqpeqlrrltqavnea
vreetffsv

SCOPe Domain Coordinates for d5uc7a1:

Click to download the PDB-style file with coordinates for d5uc7a1.
(The format of our PDB-style files is described here.)

Timeline for d5uc7a1:

  • d5uc7a1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26

View in 3D
Domains from same chain:
(mouse over for more information)
d5uc7a2