Lineage for d5mrka_ (5mrk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129933Family c.66.1.25: mRNA cap methylase [88785] (3 protein domains)
  6. 2129978Protein automated matches [190302] (8 species)
    not a true protein
  7. 2279497Species Zika virus (strain mr 766) [TaxId:64320] [322798] (7 PDB entries)
  8. 2285740Domain d5mrka_: 5mrk A: [329041]
    automated match to d2xbma_
    complexed with cl, sfg

Details for d5mrka_

PDB Entry: 5mrk (more details), 1.9 Å

PDB Description: structural basis of zika virus methyltransferase inhibition by sinefungin
PDB Compounds: (A:) Methyltransferase

SCOPe Domain Sequences for d5mrka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mrka_ c.66.1.25 (A:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
getlgekwkarlnqmsalefysykksgitevcreearralkdgvatgghavsrgsaklrw
lvergylqpygkvidlgcgrggwsyyaatirkvqevkgytkggpgheepmlvqsygwniv
rlksgvdvfhmaaepcdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcikvl
cpytstmmetlerlqrryggglvrvplsrnsthemywvsgaksntiksvsttsqlllgrm
dgprrpvkyeedvnlgsgtr

SCOPe Domain Coordinates for d5mrka_:

Click to download the PDB-style file with coordinates for d5mrka_.
(The format of our PDB-style files is described here.)

Timeline for d5mrka_:

  • d5mrka_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26