SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lmkd1 (5lmk D:176-309)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000824Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2000825Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2000826Family a.74.1.1: Cyclin [47955] (9 protein domains)
  6. 2000839Protein Cyclin A [47956] (2 species)
  7. 2000875Species Human (Homo sapiens) [TaxId:9606] [47957] (80 PDB entries)
    Uniprot P20248 175-432
  8. 2285738Domain d5lmkd1: 5lmk D:176-309 [329039]
    Other proteins in same PDB: d5lmka1, d5lmka2, d5lmkc1, d5lmkc2
    automated match to d1h1pb1
    complexed with 6zk, mg, sgm

Details for d5lmkd1

PDB Entry: 5lmk (more details), 2.4 Å

PDB Description: structure of phopsho-cdk2-cyclin a in complex with an atp-competitive inhibitor
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d5lmkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lmkd1 a.74.1.1 (D:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap

SCOPe Domain Coordinates for d5lmkd1:

Click to download the PDB-style file with coordinates for d5lmkd1.
(The format of our PDB-style files is described here.)

Timeline for d5lmkd1:

  • d5lmkd1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26