Lineage for d5m2bs_ (5m2b S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2996181Domain d5m2bs_: 5m2b S: [329035]
    Other proteins in same PDB: d5m2ba_, d5m2bb_, d5m2bc2, d5m2bf_, d5m2bg_, d5m2bh_, d5m2bi_, d5m2bj_, d5m2bk_, d5m2bl_, d5m2bm_, d5m2bn_, d5m2bo_, d5m2bp_, d5m2bq2, d5m2bt_, d5m2bu_, d5m2bv_, d5m2bw_, d5m2bx_, d5m2by_, d5m2bz_
    automated match to d4g4se_
    complexed with 7dx, cl, mg

Details for d5m2bs_

PDB Entry: 5m2b (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with thiazole based inhibitor ro19
PDB Compounds: (S:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5m2bs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m2bs_ d.153.1.0 (S:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d5m2bs_:

Click to download the PDB-style file with coordinates for d5m2bs_.
(The format of our PDB-style files is described here.)

Timeline for d5m2bs_: