SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5itcb_ (5itc B:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225114Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2225115Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2225357Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 2225358Protein automated matches [226845] (15 species)
    not a true protein
  7. 2225378Species Haloquadratum walsbyi [TaxId:362976] [275383] (5 PDB entries)
  8. 2285725Domain d5itcb_: 5itc B: [329026]
    automated match to d1cwqa_
    complexed with olb, olc, ret

Details for d5itcb_

PDB Entry: 5itc (more details), 2 Å

PDB Description: 2.2-angstrom in meso crystal structure of haloquadratum walsbyi bacteriorhodopsin (hwbr) from styrene maleic acid (sma) polymer nanodiscs
PDB Compounds: (B:) Bacteriorhodopsin-I

SCOPe Domain Sequences for d5itcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5itcb_ f.13.1.0 (B:) automated matches {Haloquadratum walsbyi [TaxId: 362976]}
lgvegegiwlalgtigmllgmlyfiadgldvqdprqkefyvitilipaiaaasylsmffg
fgltevslangrvvdvywaryadwlfttplllldigllagasqrdigalvgidafmivtg
lvatltkvvvaryafwtistismvfllyylvavfgeavsdadedtrstfnalrniilvtw
aiypvawlvgteglaltglygetllfmvldlvakvgfgfillrsraim

SCOPe Domain Coordinates for d5itcb_:

Click to download the PDB-style file with coordinates for d5itcb_.
(The format of our PDB-style files is described here.)

Timeline for d5itcb_:

  • d5itcb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26