Lineage for d5m2bd_ (5m2b D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2205325Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2205326Protein automated matches [190509] (14 species)
    not a true protein
  7. 2205369Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2285724Domain d5m2bd_: 5m2b D: [329025]
    Other proteins in same PDB: d5m2ba_, d5m2bb_, d5m2bf_, d5m2bg_, d5m2bh_, d5m2bi_, d5m2bj_, d5m2bk_, d5m2bl_, d5m2bm_, d5m2bn_, d5m2bo_, d5m2bp_, d5m2bt_, d5m2bu_, d5m2bv_, d5m2bw_, d5m2bx_, d5m2by_, d5m2bz_
    automated match to d1iruf_
    complexed with 7dx, cl, mg

Details for d5m2bd_

PDB Entry: 5m2b (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with thiazole based inhibitor ro19
PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5m2bd_:

Sequence, based on SEQRES records: (download)

>d5m2bd_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d5m2bd_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d5m2bd_:

Click to download the PDB-style file with coordinates for d5m2bd_.
(The format of our PDB-style files is described here.)

Timeline for d5m2bd_:

  • d5m2bd_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26