SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mrkb_ (5mrk B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129933Family c.66.1.25: mRNA cap methylase [88785] (3 protein domains)
  6. 2129978Protein automated matches [190302] (8 species)
    not a true protein
  7. 2279497Species Zika virus (strain mr 766) [TaxId:64320] [322798] (6 PDB entries)
  8. 2285722Domain d5mrkb_: 5mrk B: [329023]
    automated match to d2xbma_
    complexed with cl, sfg

Details for d5mrkb_

PDB Entry: 5mrk (more details), 1.9 Å

PDB Description: structural basis of zika virus methyltransferase inhibition by sinefungin
PDB Compounds: (B:) Methyltransferase

SCOPe Domain Sequences for d5mrkb_:

Sequence, based on SEQRES records: (download)

>d5mrkb_ c.66.1.25 (B:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
getlgekwkarlnqmsalefysykksgitevcreearralkdgvatgghavsrgsaklrw
lvergylqpygkvidlgcgrggwsyyaatirkvqevkgytkggpgheepmlvqsygwniv
rlksgvdvfhmaaepcdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcikvl
cpytstmmetlerlqrryggglvrvplsrnsthemywvsgaksntiksvsttsqlllgrm
dgprrpvkyeedvnlgsgtr

Sequence, based on observed residues (ATOM records): (download)

>d5mrkb_ c.66.1.25 (B:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
getlgekwkarlnqmsalefysykksgitevcrhavsrgsaklrwlvergylqpygkvid
lgcgrggwsyyaatirkvqevkgytkggpgheepmlvqsygwnivrlksgvdvfhmaaep
cdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcikvlcpytstmmetlerlq
rryggglvrvplsrnsthemywvsgaksntiksvsttsqlllgrmdgprrpvkyeedvnl
gsgtr

SCOPe Domain Coordinates for d5mrkb_:

Click to download the PDB-style file with coordinates for d5mrkb_.
(The format of our PDB-style files is described here.)

Timeline for d5mrkb_:

  • d5mrkb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26