SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ll1h1 (5ll1 H:8-142)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185755Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2185756Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2186309Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2186310Protein automated matches [227009] (13 species)
    not a true protein
  7. 2284150Species Danio rerio [TaxId:7955] [327451] (2 PDB entries)
  8. 2285709Domain d5ll1h1: 5ll1 H:8-142 [329010]
    automated match to d4n9sa1

Details for d5ll1h1

PDB Entry: 5ll1 (more details), 2.8 Å

PDB Description: crystal structure of urate oxidase from zebrafish
PDB Compounds: (H:) Uricase

SCOPe Domain Sequences for d5ll1h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ll1h1 d.96.1.0 (H:8-142) automated matches {Danio rerio [TaxId: 7955]}
nvefvrtgygknmvkvlhirregnhhhiielianvqltlktrkdyltgdnsdiiptdtvk
ntvhalaklkgiksiesfaldicehfltafnhvtrvkvnidevpwkrlekngvehnhafi
hcpealrfceaeqyl

SCOPe Domain Coordinates for d5ll1h1:

Click to download the PDB-style file with coordinates for d5ll1h1.
(The format of our PDB-style files is described here.)

Timeline for d5ll1h1:

  • d5ll1h1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26