SCOPe 2.08: Domain d5ll1h1: 5ll1 H:8-142

Lineage for d5ll1h1 (5ll1 H:8-142)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.0: automated matches [227243] (1 protein)
   not a true family

6. Protein automated matches [227009] (16 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [327451] (2 PDB entries)

8. Domain d5ll1h1: 5ll1 H:8-142 [329010]
   automated match to d4n9sa1

Details for d5ll1h1

PDB Entry: 5ll1, 2.8 Å

PDB Description: crystal structure of urate oxidase from zebrafish

PDB Compounds: (H:) Uricase

SCOPe Domain Sequences for d5ll1h1:

Sequence; same for both SEQRES and ATOM records:

>d5ll1h1 d.96.1.0 (H:8-142) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
nvefvrtgygknmvkvlhirregnhhhiielianvqltlktrkdyltgdnsdiiptdtvk
ntvhalaklkgiksiesfaldicehfltafnhvtrvkvnidevpwkrlekngvehnhafi
hcpealrfceaeqyl

Timeline for d5ll1h1:

• d5ll1h1 first appeared in SCOPe 2.06
  
• d5ll1h1 appears in SCOPe 2.07