Lineage for d1gtua2 (1gtu A:1-84)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486664Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 486798Protein Class mu GST [81359] (3 species)
  7. 486806Species Human (Homo sapiens) [TaxId:9606] [52867] (7 PDB entries)
  8. 486810Domain d1gtua2: 1gtu A:1-84 [32901]
    Other proteins in same PDB: d1gtua1, d1gtub1, d1gtuc1, d1gtud1

Details for d1gtua2

PDB Entry: 1gtu (more details), 2.68 Å

PDB Description: ligand-free human glutathione s-transferase m1a-1a

SCOP Domain Sequences for d1gtua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtua2 c.47.1.5 (A:1-84) Class mu GST {Human (Homo sapiens)}
pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

SCOP Domain Coordinates for d1gtua2:

Click to download the PDB-style file with coordinates for d1gtua2.
(The format of our PDB-style files is described here.)

Timeline for d1gtua2:

486810
d1gtua2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1gtua1