SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jtgd1 (5jtg D:13-285)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216494Fold d.328: CorA soluble domain-like [143864] (1 superfamily)
    beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel
  4. 2216495Superfamily d.328.1: CorA soluble domain-like [143865] (1 family) (S)
  5. 2216496Family d.328.1.1: CorA soluble domain-like [143866] (2 protein domains)
    N-terminal part of Pfam PF01544
  6. 2216510Protein automated matches [227110] (2 species)
    not a true protein
  7. 2216522Species Thermotoga maritima [TaxId:243274] [226608] (2 PDB entries)
  8. 2285698Domain d5jtgd1: 5jtg D:13-285 [328999]
    automated match to d2hn2a1
    complexed with mg; mutant

Details for d5jtgd1

PDB Entry: 5jtg (more details), 3.05 Å

PDB Description: crystal structure of thermotoga maritima mutant d89k/d253k
PDB Compounds: (D:) Cobalt/magnesium transport protein CorA

SCOPe Domain Sequences for d5jtgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jtgd1 d.328.1.1 (D:13-285) automated matches {Thermotoga maritima [TaxId: 243274]}
ppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinitgihrtdv
vqrvgeffgihplvlekilnvhqrpkveffenyvfivlkmftydknlheleseqvslilt
kncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvllekiddei
dvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplieketvpyfr
kvydhtiqiadtvetfrdivsglldvylssvsn

SCOPe Domain Coordinates for d5jtgd1:

Click to download the PDB-style file with coordinates for d5jtgd1.
(The format of our PDB-style files is described here.)

Timeline for d5jtgd1:

  • d5jtgd1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26