SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tdia_ (5tdi A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2154579Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2154605Protein (Pro)cathepsin K [54028] (3 species)
  7. 2154606Species Human (Homo sapiens) [TaxId:9606] [54029] (51 PDB entries)
    Uniprot P43235 116-329 ! Uniprot P43235 115-329
  8. 2285697Domain d5tdia_: 5tdi A: [328998]
    automated match to d2r6na_
    complexed with 7as

Details for d5tdia_

PDB Entry: 5tdi (more details), 1.4 Å

PDB Description: crystal structure of cathepsin k with a covalently-linked inhibitor at 1.4 angstrom resolution.
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d5tdia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tdia_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlapqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d5tdia_:

Click to download the PDB-style file with coordinates for d5tdia_.
(The format of our PDB-style files is described here.)

Timeline for d5tdia_:

  • d5tdia_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26