SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t9ub_ (5t9u B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064271Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2064272Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2064273Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 protein domains)
    automatically mapped to Pfam PF00160
  6. 2064274Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2064289Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (103 PDB entries)
    Uniprot P05092
  8. 2285695Domain d5t9ub_: 5t9u B: [328996]
    automated match to d1m9ea_
    complexed with 7hg

Details for d5t9ub_

PDB Entry: 5t9u (more details), 2.3 Å

PDB Description: discovery of a potent cyclophilin inhibitor (compound 3) based on structural simplification of sanglifehrin a
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d5t9ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t9ub_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgql

SCOPe Domain Coordinates for d5t9ub_:

Click to download the PDB-style file with coordinates for d5t9ub_.
(The format of our PDB-style files is described here.)

Timeline for d5t9ub_:

  • d5t9ub_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26