Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.328: CorA soluble domain-like [143864] (1 superfamily) beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel |
Superfamily d.328.1: CorA soluble domain-like [143865] (1 family) |
Family d.328.1.1: CorA soluble domain-like [143866] (2 proteins) N-terminal part of Pfam PF01544 |
Protein automated matches [227110] (2 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [226608] (2 PDB entries) |
Domain d5jtgb1: 5jtg B:15-285 [328990] automated match to d2hn2a1 complexed with mg; mutant |
PDB Entry: 5jtg (more details), 3.05 Å
SCOPe Domain Sequences for d5jtgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jtgb1 d.328.1.1 (B:15-285) automated matches {Thermotoga maritima [TaxId: 243274]} gtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinitgihrtdvvq rvgeffgihplvlekilnvhqrpkveffenyvfivlkmftydknlheleseqvsliltkn cvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvllekiddeidv leeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplieketvpyfrkv ydhtiqiadtvetfrdivsglldvylssvsn
Timeline for d5jtgb1:
View in 3D Domains from other chains: (mouse over for more information) d5jtga1, d5jtgc1, d5jtgd1, d5jtge1 |