Lineage for d5jtgb1 (5jtg B:15-285)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011079Fold d.328: CorA soluble domain-like [143864] (1 superfamily)
    beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel
  4. 3011080Superfamily d.328.1: CorA soluble domain-like [143865] (1 family) (S)
  5. 3011081Family d.328.1.1: CorA soluble domain-like [143866] (2 proteins)
    N-terminal part of Pfam PF01544
  6. 3011095Protein automated matches [227110] (2 species)
    not a true protein
  7. 3011107Species Thermotoga maritima [TaxId:243274] [226608] (2 PDB entries)
  8. 3011119Domain d5jtgb1: 5jtg B:15-285 [328990]
    automated match to d2hn2a1
    complexed with mg; mutant

Details for d5jtgb1

PDB Entry: 5jtg (more details), 3.05 Å

PDB Description: crystal structure of thermotoga maritima mutant d89k/d253k
PDB Compounds: (B:) Cobalt/magnesium transport protein CorA

SCOPe Domain Sequences for d5jtgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jtgb1 d.328.1.1 (B:15-285) automated matches {Thermotoga maritima [TaxId: 243274]}
gtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinitgihrtdvvq
rvgeffgihplvlekilnvhqrpkveffenyvfivlkmftydknlheleseqvsliltkn
cvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvllekiddeidv
leeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplieketvpyfrkv
ydhtiqiadtvetfrdivsglldvylssvsn

SCOPe Domain Coordinates for d5jtgb1:

Click to download the PDB-style file with coordinates for d5jtgb1.
(The format of our PDB-style files is described here.)

Timeline for d5jtgb1: