Lineage for d2gtua2 (2gtu A:1-84)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181057Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries)
  8. 181059Domain d2gtua2: 2gtu A:1-84 [32899]
    Other proteins in same PDB: d2gtua1, d2gtub1

Details for d2gtua2

PDB Entry: 2gtu (more details), 2.55 Å

PDB Description: ligand-free human glutathione s-transferase m2-2 (e.c.2.5.1.18), monoclinic crystal form

SCOP Domain Sequences for d2gtua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtua2 c.47.1.5 (A:1-84) Glutathione S-transferase {Human (Homo sapiens), class mu}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOP Domain Coordinates for d2gtua2:

Click to download the PDB-style file with coordinates for d2gtua2.
(The format of our PDB-style files is described here.)

Timeline for d2gtua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gtua1