Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5m2bh_: 5m2b H: [328977] Other proteins in same PDB: d5m2ba_, d5m2bc1, d5m2bc2, d5m2bd_, d5m2be_, d5m2bg_, d5m2bi_, d5m2bj_, d5m2bn_, d5m2bo_, d5m2bq1, d5m2bq2, d5m2br_, d5m2bs_, d5m2bu_, d5m2bw_, d5m2bx_ automated match to d4r17h_ complexed with 7dx, cl, mg |
PDB Entry: 5m2b (more details), 2.7 Å
SCOPe Domain Sequences for d5m2bh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m2bh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d5m2bh_:
View in 3D Domains from other chains: (mouse over for more information) d5m2ba_, d5m2bb_, d5m2bc1, d5m2bc2, d5m2bd_, d5m2be_, d5m2bf_, d5m2bg_, d5m2bi_, d5m2bj_, d5m2bk_, d5m2bl_, d5m2bm_, d5m2bn_, d5m2bo_, d5m2bp_, d5m2bq1, d5m2bq2, d5m2br_, d5m2bs_, d5m2bt_, d5m2bu_, d5m2bv_, d5m2bw_, d5m2bx_, d5m2by_, d5m2bz_ |