Lineage for d5ezjb2 (5ezj B:132-237)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (889 PDB entries)
  8. 2285673Domain d5ezjb2: 5ezj B:132-237 [328974]
    automated match to d2f5al2
    complexed with bma, fuc, nag

Details for d5ezjb2

PDB Entry: 5ezj (more details), 1.95 Å

PDB Description: crystal structure of fab of parasite invasion inhibitory antibody c1 - orthorhombic form
PDB Compounds: (B:) Fab c12 Light chain

SCOPe Domain Sequences for d5ezjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ezjb2 b.1.1.0 (B:132-237) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5ezjb2:

Click to download the PDB-style file with coordinates for d5ezjb2.
(The format of our PDB-style files is described here.)

Timeline for d5ezjb2:

  • d5ezjb2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26