SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ltcb_ (5ltc B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (136 species)
    not a true protein
  7. 2285669Species Vibrio cholerae [TaxId:666] [328970] (1 PDB entry)
  8. 2285671Domain d5ltcb_: 5ltc B: [328972]
    automated match to d4pdha_

Details for d5ltcb_

PDB Entry: 5ltc (more details), 2.1 Å

PDB Description: crystal structure of doubly spin labelled vcsiap r125
PDB Compounds: (B:) C4-dicarboxylate-binding periplasmic protein

SCOPe Domain Sequences for d5ltcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ltcb_ c.94.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
attlkmgmqasvgsveynsakmladtleemsqgeiklalypsaqlgddramlqcltlgdl
dityaefgrmglwipraeavmlpyvakdfdhlrrmfesdfgqgvrdemlqkfnwraldtw
yngtaettsnrplnsiedfkglklrvpnakqnlnyaklsgasptpmsfsevycalqtnav
dgqenplptiktmkfyevqknlamthhivndqmviisestwqklsdtdkdiiqkavqkvg
dahtqtvktqeaelvsffkseginvtypdlepfreamqplykefdsnigqpivsklaam

SCOPe Domain Coordinates for d5ltcb_:

Click to download the PDB-style file with coordinates for d5ltcb_.
(The format of our PDB-style files is described here.)

Timeline for d5ltcb_:

  • d5ltcb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26

View in 3D
Domains from other chains:
(mouse over for more information)
d5ltca_