Lineage for d5hqlf1 (5hql F:1-138)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2175267Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2175463Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2175464Protein automated matches [226983] (18 species)
    not a true protein
  7. 2285581Species Rhodopseudomonas palustris [TaxId:1] [328882] (1 PDB entry)
  8. 2285665Domain d5hqlf1: 5hql F:1-138 [328966]
    Other proteins in same PDB: d5hqla2, d5hqlb2, d5hqlc2, d5hqld2, d5hqle2, d5hqlf2
    automated match to d4lf2a1
    complexed with cap, mg; mutant

Details for d5hqlf1

PDB Entry: 5hql (more details), 2.53 Å

PDB Description: structure function studies of r. palustris rubisco (a47v-m331a mutant; cabp-bound; no expression tag)
PDB Compounds: (F:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hqlf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hqlf1 d.58.9.0 (F:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d5hqlf1:

Click to download the PDB-style file with coordinates for d5hqlf1.
(The format of our PDB-style files is described here.)

Timeline for d5hqlf1:

  • d5hqlf1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26