Lineage for d5jtgc1 (5jtg C:17-285)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216494Fold d.328: CorA soluble domain-like [143864] (1 superfamily)
    beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel
  4. 2216495Superfamily d.328.1: CorA soluble domain-like [143865] (1 family) (S)
  5. 2216496Family d.328.1.1: CorA soluble domain-like [143866] (2 protein domains)
    N-terminal part of Pfam PF01544
  6. 2216510Protein automated matches [227110] (2 species)
    not a true protein
  7. 2216522Species Thermotoga maritima [TaxId:243274] [226608] (2 PDB entries)
  8. 2285663Domain d5jtgc1: 5jtg C:17-285 [328964]
    automated match to d2hn2a1
    complexed with mg; mutant

Details for d5jtgc1

PDB Entry: 5jtg (more details), 3.05 Å

PDB Description: crystal structure of thermotoga maritima mutant d89k/d253k
PDB Compounds: (C:) Cobalt/magnesium transport protein CorA

SCOPe Domain Sequences for d5jtgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jtgc1 d.328.1.1 (C:17-285) automated matches {Thermotoga maritima [TaxId: 243274]}
lvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinitgihrtdvvqrv
geffgihplvlekilnvhqrpkveffenyvfivlkmftydknlheleseqvsliltkncv
lmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvllekiddeidvle
eevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplieketvpyfrkvyd
htiqiadtvetfrdivsglldvylssvsn

SCOPe Domain Coordinates for d5jtgc1:

Click to download the PDB-style file with coordinates for d5jtgc1.
(The format of our PDB-style files is described here.)

Timeline for d5jtgc1:

  • d5jtgc1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26